Diazirine-functionalized mannosides for photoaffinity labeling: trouble with FimH

  1. Femke Beiroth1,
  2. Tomas Koudelka2,
  3. Thorsten Overath2,
  4. Stefan D. Knight3ORCID Logo,
  5. Andreas Tholey2 and
  6. Thisbe K. Lindhorst1ORCID Logo

1Otto Diels Institute of Organic Chemistry, Christiana Albertina University of Kiel, Otto-Hahn-Platz 3/4, 24118 Kiel, Germany
2Systematic Proteomics & Bioanalytics, Institute for Experimental Medicine, Christiana Albertina University of Kiel, Niemannsweg 11, D-24105 Kiel, Germany
3Department of Cell and Molecular Biology, Uppsala University, Uppsala Biomedical Centre, P.O. Box 596, S-751 24 Uppsala, Sweden

  1. Corresponding author email

Associate Editor: S. Flitsch
Beilstein J. Org. Chem. 2018, 14, 1890–1900. doi:10.3762/bjoc.14.163
Received 07 May 2018, Accepted 27 Jun 2018, Published 24 Jul 2018

Abstract

Photoaffinity labeling is frequently employed for the investigation of ligand–receptor interactions in solution. We have employed an interdisciplinary methodology to achieve facile photolabeling of the lectin FimH, which is a bacterial protein, crucial for adhesion, colonization and infection. Following our earlier work, we have here designed and synthesized diazirine-functionalized mannosides as high-affinity FimH ligands and performed an extensive study on photo-crosslinking of the best ligand (mannoside 3) with a series of model peptides and FimH. Notably, we have employed high-performance mass spectrometry to be able to detect radiation results with the highest possible accuracy. We are concluding from this study that photolabeling of FimH with sugar diazirines has only very limited success and cannot be regarded a facile approach for covalent modification of FimH.

Keywords: diazirines; docking; FimH; lectin ligands; mannosides; mass spectrometry; photoaffinity labelling

Introduction

The investigation of the interactions between proteins and their ligands, such as lectins and carbohydrates, is of fundamental importance for the understanding of many biological processes. Several different methodologies are used for the elucidation of ligand–protein interactions. In addition to X-ray crystallography, studies in solution add valuable information in molecular recognition studies as they take molecular dynamics as well as solvent effects into consideration. In the latter respect, photoaffinity labeling has evolved as a useful tool for studies under physiological conditions [1-4]. Photoaffinity labeling requires a ligand equipped with a photolabile group, which can be converted into a highly reactive intermediate upon irradiation with light of an appropriate wavelength. This technique involves incubation of the photolabile ligand with the target protein (receptor) and irradiation of the ligand–protein complex to form an excited intermediate, which eventually leads to a covalently crosslinked ligand–receptor conjugate, which has to be identified by mass spectrometry (Figure 1).

[1860-5397-14-163-1]

Figure 1: Principle of photoaffinity labeling of proteins with diazirine derivatives. Photolabile ligands are complexed with the receptor protein and the following photochemical excitation of the complex leads to formation of a reactive carbene after extrusion of nitrogen and a crosslinked product after insertion reaction; X = e.g., NH, O, CH2.

Three widely used photoreactive groups are aryl azides, benzophenones and diazirines. They differ with respect to their steric properties, photochemistry, and reactivity. In order to be applied in a biological environment, the wavelength of the light required for activation of the photolabile ligand has to be biocompatible. Furthermore, small photophores are desirable. Diazirines meet these requirements particularly well. The diazirine photophore is small and its photoactivation is possible at wavelengths around 350 nm and thus does not perturb protein structures. According to the literature, irradiation of a diazirine-functionalized ligand leads to a reactive carbene which can insert into OH, NH, or CH groups of a protein in a fast reaction [5,6]. Further advantages of the diazirine group are its robustness at different pH values and its stability against nucleophiles. However, besides desired insertion reactions, carbenes can undergo unwanted side reactions, in particular olefin formation through abstraction of α-H atoms. Therefore, aryl(trifluoromethyl)diazirines were introduced, which lack hydrogen atoms in α-position of the diazirine function and consequently do not form olefins. Thus, aryl(trifluoromethyl)diazirines have become reagents of first choice for photolabeling studies [7,8].

Over several years it has been our goal, to exploit diazirine-labeled mannopyranosides for protein labeling. In the course of this work, we have gradually improved our target design and synthetic procedures [9-11] with the aim to eventually address the bacterial lectin FimH. Finally, back in 2010, we analyzed photolabeling of the octapeptide angiotensin II with three different sugar diazirines using mass spectrometry and then also detected photolabeling of FimH with the same three mannosides. However, we could not measure the labeling product with full accuracy [11]. Although these results were even recognized in a recent review [12], they unfortunately did not help to consolidate our projects on photoaffinity labeling of FimH, but instead this methodology remained problematic in our hands. Until to date, no reliable ligands for photolabeling of FimH are available.

We reasoned that high performance mass spectrometry-based proteomics could lead to more robust success in our approach to employ tailor-made sugar ligands for FimH labeling. Here, we report on the difficulties of FimH labeling even when computer-aided design and synthesis of photolabile FimH were combined with optimized photolabeling conditions and high-end mass spectrometry.

Results and Discussion

FimH is a fimbrial lectin found at the tips of adhesive organelles (type 1 fimbriae), which are projecting from the surface of enterobacteriaceae such as E. coli. Fimbriae mediate firm attachment (adhesion) of bacteria to the glycosylated surface of their target cells and constitute important virulence factors in bacterial infection such as urinary tract infection [13-16]. Hence, FimH is an interesting target protein in medicinal chemistry and proteomics [17,18]. It is a two-domain protein comprising a lectin domain FimHL hosting the α-D-mannose-specific carbohydrate binding site and a pilin domain FimHP connecting the protein to the fimbrial shaft (Figure 2).

[1860-5397-14-163-2]

Figure 2: FimH crystal structure (pdb code 1KLF) with docked p-nitrophenyl α-D-mannopyranoside (1, pNPMan). FimH is a two-domain protein comprising a lectin domain (FimHL) with the carbohydrate binding site (top) and a pilin domain (FimHP, bottom) that anchors the lectin onto the fimbrial shaft. For photoaffinity labeling, a truncated version of the protein (FimHtr) was used. The carbohydrate binding site is depicted as Connolly surface and colored according to the electrostatic potential. The picture was generated with glide and rendered with maestro, both implemented in Schrödinger software.

Complexation of α-D-mannopyranoside ligands involves the entire mannoside glycon moiety whereas the aglycon portion sticks out of the binding site, undergoing interactions with the protein surface, which add to affinity. Especially CH–π or π–π interactions of a sugar ligand with the side chains of Y48 and Y137, called the “tyrosine gate” [19,20], are known to considerably increase the affinity of a specific mannoside for FimH. Consequently, α-D-mannopyranosides having an aromatic aglycon portion such as p-nitrophenyl α-D-mannopyranoside (1) and the squaric acid derivative 2 [19] (Figure 3) were identified as FimH ligands with relative high affinity (low μmolar range). Based on this knowledge, we proposed the three diazirine-labeled mannosides 35 as photolabile ligands of FimH and evaluated their potential affinity by computer-aided docking.

[1860-5397-14-163-3]

Figure 3: Based on the structure of the known FimH ligands 1 and 2, three photolabile α-D-mannosides, 35, were considered for FimH labeling. In 3 and 4 the distance between the diazirine functional group and the anomeric center of the mannoside are varied. In 5 a bis-diazirine functionalization is suggested to increase labeling probability.

Docking studies

Mannosides 35 (Figure 3) were docked into the FimH carbohydrate binding site using FlexX as implemented in Sybyl 6.9 [21-23]. Ligand structures were minimized using the Tripos force field and 30 different conformers of each ligand were docked into two different X-ray structures of FimH (for details see Supporting Information File 1). These two crystal structures differ in the conformation of the tyrosine gate, formed by Y48 and Y137 positioned at the entrance of the carbohydrate binding site. They are flexible and can be more distant to one another (“open gate”) or closer together (“closed gate”) [20]. Both conformations were considered for the docking studies. For each docked conformation, a scoring value is obtained that correlates with the affinity of the ligand to the carbohydrate binding site. A more negative value predicts better binding. Scores obtained for mannosides 3 and 4 suggest a high affinity for FimH, surpassing that of pNPMan 1 for both protein conformations tested (Table 1). (Diazirines cannot be tested in bacterial adhesion–inhibition assays due to their light sensitivity.)

Table 1: FlexX scoring values for photolabile mannosides 35 in comparison with methyl α-D-mannopyranoside (MeMan) and pNPMan 1 for the open and closed gate crystal structure of FimH (PDB 1KLF and 1UWF, respectively).

Ligand FlexX scoring value open gate FlexX scoring value closed gate
MeMan −22.5 −23.3
1 −24.9 −27.4
3 −34.7 −36.2
4 −28.6 −34.0
5 −18.8

The bivalent ligand 5, on the other hand, seems to be sterically too demanding to allow good complexation with the carbohydrate binding site of FimH; mainly unspecific interactions with the surface of FimH were predicted in this case. Thus, synthesis of 5 was not undertaken. In contrast, the diazirine 3, with scoring values of −34.7 (open gate) and −36.2 (closed gate), is predicted as suitable FimH ligand with high affinity. Additionally, docking suggests that the diazirine function of 3 is positioned in close proximity to the protein surface, making a specific insertion reaction of the carbene formed after irradiation very likely (involving for example Y48 or T51, Figure 4). Docking of mannoside 4 also delivered good scoring values and therefore both photolabile ligands 3 and 4 were synthesized.

[1860-5397-14-163-4]

Figure 4: Connolly representation of photolabile α-D-mannoside 3 in the closed gate (A, PDB code 1UWF) and open gate crystal structure of FimH (B, PDB code 1KLF) [24]. The surface is colored according to the lipophilic potential, where brown reflects more hydrophobic and blue more hydrophilic amino acid residues [25]. Amino acid residues Y48 and Y137, forming the “tyrosine gate” are highlighted as well as T51, which is a good candidate for photolabeling.

Synthesis of photolabile mannosides

The synthesis of the photolabile mannosides 3 and 4 started from p-nitrophenyl α-D-mannopyranoside (1), which was first reduced to the corresponding amine 6 [26,27] by catalytic hydrogenation (Scheme 1). HATU-mediated peptide coupling with Boc-protected glycine under basic conditions led to 7. After removal of the Boc protecting group using trifluoroacetic acid in water, the resulting crude product was subjected to a subsequent peptide-coupling reaction employing the carboxy-functionalized diazirine 8.

[1860-5397-14-163-i1]

Scheme 1: Synthesis of photolabile α-D-mannosides 3 and 4. a) H2, Pd-C, methanol, rt, 6 h, 94%; b) HATU, DIPEA, dry DMF, N2, rt, overnight, quant.; c) 1. 50% TFA in water, rt, 3 h; 2. HATU, 8, DIPEA, dry DMF, N2, rt, 14 h, 19% (over 2 steps); d) dry methanol, rt, 16 h, 59%; e) Et3N, dry methanol, rt, 15 h, 92%; f) 1. 50% TFA in water, rt, 3 h; 2. HATU, 8, DIPEA, dry DMF, N2, rt, overnight, crude product (68% over 2 steps).

Diazirine 8 was prepared in a nine-step synthesis according to the literature [28]. For the synthesis of ligand 4, mannoside 6 was first converted into the squaric acid monoester 10 employing squaric acid diester 9. The monoester 10 was reacted with N-Boc-ethylendiamine to obtain the squaric acid diamide 11. Then removal of the Boc protecting group with trifluoroacetic acid followed by peptide coupling with the diazirine 8 led to target molecule 4. However, purification of the photolabile mannosides is problematic due to their poor solubility and the light sensitivity of the diazirine moiety. Therefore, the products often contain minor impurities after chromatography resulting from light-induced activation of the diazirine and insertion reaction. This can be monitored by 19F NMR spectroscopy showing the typical diazirine CF3 signal around −68 ppm [29]. Whereas mannoside 3 was received in good purity, compound 4 was always obtained with contaminations. Thus, 3 was the preferred ligand for the following photolabeling experiments. Results obtained with mannoside 4 were less promising and are not reported here. After all, also modeling had suggested that 3 has a higher affinity for FimH than 4.

To test carbene formation, mannoside 3 was irradiated at 345 nm in 1:1 acetonitrile/water as well as in 1:1 DMSO/water mixtures with 4-hydroxybenzyl alcohol as the simplest tyrosine mimic. Mass-spectrometric analysis indicated the desired crosslinked product as well as insertion into water in both cases (cf. Supporting Information File 1, Table S5). Hence, carbene formation upon irradiation of diazirine 3 was ensured and thus we continued further labeling studies with more complex substrates.

Irradiation of mannoside 3 and model peptides

In analogy to our earlier work, we first used a series of model peptides (M2, M3, M7, M8, T3, and S17, cf. Table 2) for the photolabeling experiments with mannoside 3. These model peptides were chosen rather arbitrarily as we have frequently employed them to optimize mass spectrometric procedures. Also, we were interested to test, if threonine or tyrosine residues, respectively, would lead to better labeling efficiency. Because mannoside 3 is poorly water soluble, it was dissolved in methanol and then added to the peptides in a 1:1 ratio. After irradiation with UV light, two new signals were detected in nano-LC–ESIMS experiments in comparison to the original peptide spectra (Table 2). It should be noted that whereas we could monitor photodecomposition of the photolabels by 19F NMR spectroscopy (cf. [29]), we could not observe labeled products by fluorine NMR. This is presumably due to the low labeling efficiency as in the literature 19F NMR spectra were obtained with proteins having 19F-labeled amino acids incorporated [30].

Table 2: ESIMS data of peptide labeling with ligand 3 (cf. Supporting Information File 1 for all details).

Peptide Peptide mass (M) Detected masses after labeling (m/z)
ILMEHIHKL (M2) 1132.6499 531.1584 [M + H]+ a, 832.4043 [M + 2H]2+ b (Figure 5)
YLLPAIVHI (M3) 1037.6274 531.1584 [M + H]+ a, 784.8971 [M + 2H]2+ b (Figure S11, Supporting Information File 1)
EIAMATVTALR (M7) 1174.6380 531.1586 [M + H]+ a, 853.4019 [M + 2H]2+ b (Figure S14, Supporting Information File 1)
ETIGEILKK (M8) 1029.6071 531.1587 [M + H]+ a, 780.8868 [M + 2H]2+ b (Figure S17, Supporting Information File 1)
EGHIARNCRA (T3) 1125.5462 531.1588 [M + H]+ a, no adduct observed (Figure S20, Supporting Information File 1)
RPQYAEASWNAR (S17) 1447.6957 531.1585 [M + H]+ a, 989.9307 [M + 2H]2+ b (Figure S21, Supporting Information File 1)

aInsertion product of 3 − N2 + H2O; bAdduct of 3 − N2 + H2O to the peptide.

Disappointingly, instead of crosslinking, we observed two different other products in all cases. As an example, for peptide M2 one peak at m/z 531.1584 ([M + H]+) could be assigned to the ligand 3 that had reacted with a water molecule instead of the peptide (Figure 5). The second signal of low intensity in this spectrum at m/z 832.4043 corresponds to the peptide mass plus hydrolyzed carbene. However, MS/MS fragmentation of both the unmodified peptide (567.3281)2+ and the allegedly modified peptide (832.4043)2+ exhibited the same b- and y-ion series (cf. Supporting Information File 1, Figure S10). Accordingly, the low intensity peak is most likely the result of non-covalent binding of hydrolyzed 3 to the peptide M2 rather than a covalent modification at one of the peptide’s side chains. The same situation was found for all other peptides irradiated with the photolabile ligand 3 (cf. Supporting Information File 1).

[1860-5397-14-163-5]

Figure 5: ESIMS spectra of peptide M2 before (A) and after photoreaction (B) with mannoside 3.

Irradiation of mannoside 3 and FimH-truncate

Whereas we first expected that it would be easier to photolabel peptides than FimH, after the failure with photolabeling of the model peptides we were hoping that labeling of FimH would be more successful, as our ligand was designed to bind to FimH. We reasoned that complexation of the photolabile mannoside 3 and FimH could support the desired crosslinking reaction. Thus, the high affinity of 3 for FimH would facilitate insertion of the carbene, which is formed after irradiation, into OH, NH or CH groups, respectively, in proximity of the lectin’s carbohydrate binding site. We were hoping that after our initial success in 2010 [11], high performance MS analysis would lead to results of higher accuracy. Indeed, we could detect FimHtr labeling after irradiation with 3, however, photolabeling was not at all efficient. Only after extensive and tedious optimization of reaction conditions, a new peak was observed by mass spectrometry on the intact protein level (Figure 6). For this, the photolabile mannoside 3 was incubated with FimH truncate (FimHtr) in buffer and 50% ACN or 10% DMSO, respectively, and irradiated with UV light.

[1860-5397-14-163-6]

Figure 6: Intact protein ESIMS spectra of FimHtr labeling with diazirine derivative 3 with (A) 50% acetonitrile or (B) 10% DMSO additive. (C) Minor peak at 1412.8578, as part of spectrum A, representing the covalently bound label. Zoom into the signal at charge state +13. Labeling yield calculated from peak intensities compared to the corresponding signal of unlabeled peptide: 1.41% (50% acetonitrile). (D) Minor peak at 1412.8551, as part of spectrum B, representing the covalently bound label. Labeling yield calculated from peak intensities compared to corresponding signal of unlabeled peptide: 1.55% (10% DMSO). The theoretically expected mass of labeled FimHtr is 1412.9333 Da. The fact that the most abundant isotope was not 1412.9333, but 1412.8578 and 1412.8551 Da is simply due to the high signal to noise ratio of the spectra as a result of low labeling efficiency.

The theoretically most abundant isotope peak of unbound FimHtr (1373.4608 Da, z = 13) fits to the most abundant experimentally observed mass for unbound FimHtr with 1373.4616 Da (Figure 6A) and 1373.5375 Da (Figure 6B) with small deviations. The presence of a new peak at 1412.8578 Da (z = 13, Figure 6C) and 1412.8551 Da (z = 13, Figure 6D), respectively, corresponded very well with insertion of the photolabile mannoside 3. In this case, non-covalent bonding of the photolabile mannoside 3 to the substrate (FimHtr) could be ruled out, as this would have led to a significantly higher mass according to the intact label 3 with a relative mass shift of ≈1.38 (at z = 13). In addition, under the LC–ESIMS conditions applied here, e.g., low pH and use of organic eluents in ion-paring reversed-phase chromatography, as well as under the ESI conditions employed, non-covalent bonding of the photolabile mannoside to FimH is unlikely to be observed. Due to the low labeling yield obtained, all our attempts to identify the specific position of FimH labeling by peptic digestion of the labeled protein and following MS/MS analysis were unsuccessful.

Conclusion

In continuation of our earlier work, we have employed an advanced interdisciplinary approach to identify diazirine-labeled mannoside ligands for facile and reliable photolabeling of the bacterial lectin FimH. We could indeed show photolabeling of the protein with the designer mannoside 3 with much higher accuracy than before. However, a great excess of ligand was needed and only traces of labeled FimH were observed. Due to the high-performance mass spectrometry which was employed here, this result can be considered specific. However, it was not possible to identify the site of labeling due to the low labeling yield. Photolabeling of FimH with sugar diazirines remains difficult and thus this approach is not very likely to be developed into a standard method for FimH labeling. As we wish to eventually control bacterial adhesion by crosslinking of functional molecules to the adhesin (FimH), we will in the future utilize alternative labeling chemistry to efficiently target FimH.

Experimental

Peptides and proteins

For photolabeling experiments model peptides from Biosynthan (Berlin) were used: ILMEHIHKL (M2), YLLPAIVHI (M3), EIAMATVTALR (M7), ETIGEILKK (M8), EGHIARNCRA (T3), and RPQYAEASWNAR (S17). Furthermore, FimH truncate (FimHtr) was used, which was expressed and purified in the laboratory of the S. D. Knight according to [31]. FimHtr has the following amino acid sequence: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNL-VVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSG-TVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLT-PVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQF-VWNIYANNDVVVPTGGHHHHHH.

Docking studies

Computer-aided docking studies were performed to evaluate the binding affinity of FimH ligands using FlexX flexible docking and consensus scoring, both implemented in Sybyl 6.9, as described earlier [19]. Two published X-ray structures of FimH (PDB codes 1KLF and 1UWF) were considered. During docking, the receptor was held fixed whereas the ligand was allowed to change its conformation. All calculations were done with the Tripos force field.

Peptides

To 500 pmol of a model peptide (cf. Table 1) dissolved in 5 µL double distilled water (18 MΩ) with 5% acetonitrile (ACN), 500 pmol of ligand solution (3 in 12.9 µL methanol) was added and incubated for 10 min at 37 °C and 100 rpm. Subsequently, the solution was irradiated under ice cooling with a medium pressure mercury vapor lamp for 10 min. Afterwards, 50 µL double distilled water were added and 2 µL of this solution given to 20 µL of a 0.1% trifluoroacetic acid (TFA) solution, desalted with a C18 µZipTip and spotted on a MALDI-plate together with 5 mg/mL α-cyano-4-hydroxycinnamic acid (HCCA) matrix (70% ACN in 0.1% TFA solution in double distilled water). MALDI–TOF MS was performed on a AB 5800 MS (AB Sciex, Darmstadt, Germany) in positive ion mode.

FimHtr

FimHtr (3.36 nmol) was dissolved in PBS buffer (pH 7.8). Ligand 3 was dissolved in ACN or DMSO. The ratio ligand to protein was 70:1. The total volume of the reaction was 11 µL either with 50% ACN or 10% DMSO. Ligand and protein were combined and incubated for 10 min at 37 °C and 100 rpm. Afterwards the solution was irradiated under ice cooling with a medium pressure mercury vapor lamp for 10 min. The protein solution was then investigated by ESI mass spectrometry.

LC–MS methods

Nano-LC–MS was performed on the U3000 nano-LC-UV system (Dionex, Idstein, Germany) coupled online to a LTQ Orbitrap Velos mass spectrometer equipped with LTQ Tune Plus 2.7.0 and XCalibur 2.2 (all Thermo Fisher Scientific). The column oven was set to 30 °C and the UV trace was monitored at a wavelength of 214 nm. The modified FimHtr (10 pmol) was desalted on a C4 trap column (Acclaim PepMap C-4, 300 µm i.d. × 5 mm, 5 µm, 300 Å, Thermo Fisher Scientific) using a flow rate of 30 µL/min. After 5 min, the analytes were eluted with a flow rate of 300 nL/min onto an analytical monolithic column (ProSwift RP-4H, 100 µm × 250 mm, Thermo Fisher Scientific) using eluent A (0.05% formic acid (FA)) and eluent B (80% ACN in 0.04% FA). A gradient from 5 to 95% B was applied over 30 min followed by a 10 min washing step at 95% B and a 15 min equilibration step at 5% B. MS data were recorded in MS full scan mode between 400 and 2000 m/z using 445.120025 as a lock mass. Data were recorded at a resolution of 60,000 in profile mode. To obtain better quality MS data, no MS/MS data were acquired. Raw files were opened in XCalibur 2.2 and spectra during which FimHtr was observed were averaged. Theoretical spectra of FimHtr were compared to the experimental spectra using IDCalc (version 0.3). Experimental spectra were calculated in profile mode using a charge state of 13 and at a resolution of 35,000 (the actual resolution observed at m/z of 13 for FimHtr) and an elemental composition of truncated and his-tagged FimH with a disulfide bond (C803H1213O242N217S2). The relative peak abundances were extracted and compared to the theoretical spectra. A change in molecular composition upon addition of the diazirine 3 (C23H23F3N2O8) was appended to the elemental composition of FimHtr.

Methods and materials for synthesis

TLC was performed on silica gel GF254 (Merck). Spots were visualized under UV light and by charring with 10% sulfuric acid in ethanol and subsequent heating. Flash column chromatography was performed on silica gel 60 (230–400 mesh, particle size 40–63 µm, Merck). All used solvents were distilled. NMR spectra were recorded on Bruker DRX 500 or Bruker Avance 600 instruments at 300 K. Chemical shifts are relative to the solvent peak of MeOD (3.35 ppm and 4.78 ppm for 1H, 49.3 for 13C). Assignments of the signals were done using 2D experiments (COSY, HSQC and HMBC). IR spectra were measured with a Perkin Elmer FT IR Paragon 1000 (KBr). Optical rotation values were determined with a Perkin-Elmer polarimeter (589 nm, length of cuvette: 1 dm). MS analysis of synthetic products were carried out with a MALDI–TOF mass spectrometer Bruker Biflex III with 19 kV acceleration voltage (matrix: 2,5-dihydroxybenzoic acid) and with a ESI–TOF MS spectrometer Applied Biosystems Mariner ESI–TOF 5280. UV data were obtained with the Perkin-Elmer UV–vis spectrometer Lambda 14 at 25 °C. All reactions and purification steps of diazirine compounds were performed in the dark.

N-{2-Oxo-2-[(4-(α-D-mannopyranosyloxy)phenyl)amino]ethyl}-4-(3-trifluoromethyl-3H-diazirin-3-yl)benzamide (3). The glycoamino acid 7 (52.8 mg, 160 µmol) was dissolved in distilled water which contained 50% TFA (5 mL). The solution was then stirred at room temperature for 3 h. After complete conversion, the solvent was removed under reduced pressure, co-distilled with toluene and neutralized with basic ion exchange resin in methanol. The crude product was then dried together with diazirine 8 [28] (27.6 mg, 120 µmol) and HATU (83.7 mg, 220 µmol) for 1 h under vacuum. Subsequently this was mixture dissolved in dry DMF (5 mL) and DIPEA (20.0 µL, 140 µmol). The solution was stirred at room temperature for 14 h. The solvent was removed under reduced pressure and the residue purified by flash column chromatography (ethyl acetate/methanol 5:1). The product was isolated as a colorless solid (17.2 mg, 30.0 µmol, 19%); Rf = 0.76 (ethyl acetate/methanol 2:1); UV–vis (MeOH) λmax: 345 nm; FTIR (KBr) [Graphic 1]: 3317, 2927, 2503, 2093, 1671, 1637, 1550, 1511, 1224, 1015, 940, 681 cm−1; 1H NMR (500 MHz, MeOH-d4) δ 7.99 (d, 3J = 8.5 Hz, 2H, CHaryl-2‘,6‘), 7.48 (d, 3J = 9.1 Hz, 2H, CHaryl-2,6), 7.36 (d, 3J = 8.5 Hz, 2H, CHaryl-3‘,5‘), 7.08 (d, 3J = 9.1 Hz, 2H, CHaryl-3,5), 5.43 (d, 3J1,2 = 1.7 Hz, 1H, H-1), 4.18 (s, 2H, CH2-Glycin), 3.99 (dd, 3J1,2 = 1.7 Hz, 3J2,3 = 3.4 Hz, 1H, H-2), 3.89 (dd, 3J3,2 = 3.4 Hz, 3J3,4 = 9.4 Hz, 1H, H-3), 3.76 (dd, 3J6,5 = 2.5 Hz, 2J6,6‘ = 11.9 Hz, 1H, H-6), 3.73 (mc, 1H, H-4), 3.71 (dd, 3J6‘,5 = 5.1 Hz, 2J6‘,6 = 11.9 Hz, 1H, H-6‘), 3.61 (ddd, 3J5,6 = 2.5 Hz, 3J5,6‘ = 5.1 Hz, 3J5,4 = 9.8 Hz, 1H, H-5) ppm; 13C NMR (126 MHz, MeOH-d4) δ 171.6 (1C, CN2), 169.5 (1C, C=O), 169.2 (1C, C=O), 154.7 (1C, Caryl-4), 136.7 (1C, Caryl-1‘), 134.1 (1C, Caryl-1), 133.3 (1C, Caryl-4‘), 129.3 (2C, CHaryl-2‘,6‘), 127.7 (2C, CHaryl-3‘,5‘), 122.9 (2C, CHaryl-2,6), 121.3 (1C, q, J = 274.9 Hz, CF3), 118.2 (2C, CHaryl-3,5), 100.6 (1C, C-1), 75.4 (1C, C-5), 72.4 (1C, C-3), 72.0 (1C, C-2), 68.4 (1C, C-4), 62.7 (1C, C-6), 44.4 (1C, CH2-glycine) ppm; 19F NMR (471 MHz, MeOH-d4) δ −66.87 (s) ppm; ESIMS m/z: 579.12 [M + K]+, 563.14 [M + Na]+, 535.13 [(M + Na) − N2]+; HRESIMS m/z: [M + H]+ calcd. for C23H23F3N4O8, 541.15408; found, 541.15424.

{N-[4-(α-D-Mannopyranosyloxy)phenyl]-N’-[2’-(4’’-(3-trifluoromethyl-3H-diazirin-3-yl)phenylamido)ethyl]}squaric acid diamide (4). The squaric acid diamide 11 (152 mg, 290 µmol) was dissolved in distilled water which contained 50% TFA (9 mL). The solution was then stirred at room temperature for 3 h. After complete conversion, the solvent was removed under reduced pressure, codistilled with toluene and neutralized with basic ion exchange resin in methanol. The resin was filtered off and the solvent removed under reduced pressure. The primary amine was then dried under vacuum together with the diazirine 8 [28] (56.0 mg, 250 µmol) und HATU (114 mg, 300 µmol) for 30 min. The substances were dissolved in dry DMF (10 mL) and DIPEA (20.0 µL, 180 µmol) was added. The solution was stirred at room temperature for 16 h. Subsequently, the solvent was removed under reduced pressure and the crude product was purified by flash column chromatography (dichloromethane/methanol 8:1→4:1). The product was obtained as a colorless solid (123 mg) containing minor amounts of side products which could not be separated (crude yield 68%). 1H NMR (500 MHz, MeOH-d4) δ 7.96–7.92 (m, 2H, CHaryl-2‘,6‘), 7.39 (d, 3J = 8.8 Hz, 2H, CHaryl-2,6), 7.35 (d, 3J = 8.2 Hz, 2H, CHaryl-3‘,5‘), 7.14–7.10 (m, 2H, CHaryl-3,5), 5.47 (d, 3J1,2 = 1.8 Hz, 1H, H-1), 4.04 (dd, 3J2,1 = 1.8 Hz, 3J2,3 = 3.4 Hz, 1H, H-2), 3.93 (dd, 3J3,2 = 3.4 Hz, 3J3,4 = 9.4 Hz, H-3), 3.80 (dd, 3J6,5 = 2.6 Hz, 2J6,6‘ = 12.0 Hz, 1H, H-6), 3.78–3.73 (m, 2H, H-4, H-6‘), 3.70–3.66 (m, 2H, CH2-ethyl) 3.64 (ddd, 3J5,4 = 9.8 Hz, 3J5,6‘ = 4.5 Hz, 3J5,6 = 2.6 Hz, 1H, H-5), 3.29–3.23 (m, 2H, CH2-ethyl) ppm; 13C NMR (126 MHz, MeOH-d4, 300 K) δ 169.3, 165.6 (2C, Csquaric acid), 154.6 (1C, Caryl-4), 137.0 (1C, Caryl-1‘‘), 134.6 (1C, Caryl-1), 133.2 (1C, Caryl-4’’), 129.1 (2C, CHaryl-2‘‘,6‘‘), 127.7 (2C, CHaryl-3‘‘,5‘‘), 121.5 (2C, CHaryl-2,6), 118.7 (2C, CHaryl-3,5), 100.6 (1C, C-1), 75.4 (1C, C-5), 72.4 (1C, C-3), 72.0 (1C, C-2), 60.3 (1C, C-4), 62.6 (1C, C-6), 43.8 (1C, CH2-ethyl), 42.1 (1C, CH2-ethyl) ppm; not visible owing to slow relaxation: 2 squaric acid C=O), CF3; 19F NMR (471 MHz, MeOH-d4) δ −66.84 (s) ppm; MALDI–TOF MS m/z: 620.72 [M]+.

Nα-Boc-glycin-[p-(α-D-mannopyranosyloxy)]phenyl amide (7). The aminophenyl mannoside 6 [26,27] (150 mg, 553 µmol) was dried together with N-Boc-glycine (64.6 mg, 369 µmol) and HATU (280 mg, 738 µmol) for 45 min under vacuum. Afterwards, this mixture was dissolved in dry DMF (8 mL), DIPEA (80.0 µL, 443 µmol) was added and the reaction mixture stirred overnight at room temperature. The solvent was removed under vacuum and purified with flash column chromatography (ethyl acetate/methanol 6:1) leading to a colorless solid (158 mg, 369 µmol, quant.); Rf = 0.15 (ethyl acetate/methanol 6:1); mp 74 °C; [α]D21 = 91.8 (c 0.5, MeOH); FTIR (KBr) [Graphic 2]: 3388, 2936, 1660, 1508, 1445, 1368, 1220, 1161, 1015, 978, 835, 556 cm−1; 1H NMR (600 MHz, MeOH-d4) δ 7.46 (d, 3J = 8.9 Hz, 2H, CHaryl-2,6), 7.08 (d, 3J = 8.9 Hz, 2H, CHaryl-3,5), 5.43 (d, 3J1,2 = 1.8 Hz, 1H, H-1), 3.99 (dd, 3J2,1 = 1.8 Hz, 3J 2,3 = 3.4 Hz, 1H, H-2), 3.89 (dd, 3J3,2 = 3.4 Hz, 3J3,4 = 9.4 Hz, 1H, H-3), 3.84 (s, 2H, CH2-Glycin), 3.76 (dd, 3J6‘,5 = 2.4 Hz, 2J6‘,6 = 11.9 Hz, 1H, H-6‘), 3.75–3.69 (m, 2H, H-6, H-4), 3.61 (ddd, 3J5,6‘ = 2.4 Hz, 3J5,6 = 5.1 Hz, 3J5,4 = 9.4 Hz, 1H, H-5), 1.47 (s, 9H, C(CH3)3) ppm; 13C NMR (151 MHz, MeOH-d4) δ 170.4 (1C, C=Oglycine), 158.6 (1C, C=OBoc), 154.6 (1C, Caryl-4), 134.1 (1C, Caryl-1), 122.9 (2C, CHaryl-2,6), 118.1 (2C, CHaryl-3,5), 100.5 (1C, C-1), 80.7 (1C, C(CH3)3), 75.4 (1C, C-5), 72.4 (1C, C-3), 72.0 (1C, C-2), 68.4 (1C, C-4), 62.7 (1C, C-6), 45.0 (1C, CH2-glycine), 28.7 (3C, C(CH3)3) ppm; MALDI–TOF MS m/z: 451.10 [M + Na]+; ESIMS m/z: 448.3 [M + Na]+, 467.3 ([M + K]+.

N-{[4-(α-D-Mannopyranosyloxy)phenyl]amido}squaric acid methyl ester (10). To a solution of the aminophenyl mannoside 6 [26,27] (200 mg, 737 µmol) in dry methanol (15 mL), squaric acid dimethyl ester (9, 314 mg, 2.21 mmol) was added. The solution was stirred at room temperature for 16 h. Subsequently, the solvent was removed under reduced pressure and the crude product was purified by flash column chromatography (ethyl acetate/methanol 3:1). The product was isolated as a colorless solid (166 mg, 436 µmol, 59%); Rf = 0.43 (ethyl acetate/methanol, 2:1); mp 198 °C (decomp.); [α]D21 = +88.0 (c 0.4, DMSO); FTIR (KBr) [Graphic 3]: 3260, 1797, 1698, 1624, 1586, 1396, 1234, 1004, 811 cm−1; 1H NMR (200 MHz, MeOH-d4) δ 7.30 (d, 3J = 9.0 Hz, 2H, CHaryl-2,6), 7.12 (d, 3J = 9.0 Hz, 2H, CHaryl-3,5), 5.45 (d, 3J1,2 = 1.8 Hz, 1H, H-1), 4.44 (s, 3H, OCH3), 4.01 (dd, 3J2,1 = 1.8 Hz, 3J2,3 = 3.4 Hz, 1H, H-2), 3.89 (dd, 3J3,2 = 3.4 Hz, 3J3,4 = 9.4 Hz, 1H, H-3), 3.80 (dd, 3J6‘,5 = 2.8 Hz, 2J6‘,6 = 11.9 Hz, 1H, H-6‘), 3.73 (dd~t, 3J4,3 = 3J4,5 = 9.4 Hz, 1H, H-4), 3.71 (dd, 3J6,5 = 4.6 Hz, 2J6,6‘ = 11.9 Hz, 1H, H-6), 3.60 (ddd, 3J5,6‘ = 2.8 Hz, 3J5,6 = 4.6 Hz, 3J5,4 = 9.4 Hz, 1H, H-5) ppm; 13C NMR (151 MHz, MeOH-d4, 300 K) δ 193.9, 193.6 (2C, C=Osquaric acid), 179.8, 164.9 (2C, Csquaric acid), 154.4 (1C, Caryl), 132.8 (1C, Caryl), 122.6 (2C, CHaryl), 118.5 (2C, CHaryl), 100.5 (1C, C-1), 75.5 (1C, C-5), 72.4 (1C, C-3), 72.0 (1C, C-2), 68.4 (1C, C-4), 62.7 (1C, C-6), 59.8 (1C, OCH3) ppm; MALDI–TOF MS m/z: 404.46 [M + Na]+.

{N-[4-(α-D-Mannopyranosyloxy)phenyl]-N’-[(2‘-tert-butyloxycarbonylamido)ethyl]}squaric acid diamide (11). The squaric acid monoamide 10 (90.0 mg, 240 µmol) was dissolved in dry methanol (5 mL). Afterwards, N-Boc-ethylendiamine (46.0 mg, 465 µmol) and triethylamine (140 µL) were added. The reaction solution was stirred at room temperature for 15 h. The solution was neutralized with an acidic ion exchange resin (Amberlyst-A21), filtered and concentrated under reduced pressure. The crude product was purified by column chromatography (ethyl acetate/methanol 3:1), leading to a colorless solid (114 mg, 220 µmol, 92%); Rf = 0.44 (ethyl acetate/methanol 3:1); mp 176–185 °C (decomp.); [α]D25 = +72.1 (c 0.3, CH3OH); FTIR (KBr) [Graphic 4]: 3359, 2970, 2933, 1798, 1689, 1650, 1609, 1550, 1514, 1454, 1285, 1118, 1021, 918, 881, 826, 765 cm−1; 1H NMR (500 MHz, MeOH-d4) δ 7.34 (d, 3J = 8.8 Hz, 2H, CHaryl-2,6), 7.13 (d, 3J = 8.8 Hz, 2H, CHaryl-3,5), 5.44 (d, 3J1,2 = 1.9 Hz, 1H, H-1), 4.00 (dd, 3J2,1 = 1.9 Hz, 3J2,3 = 3.5 Hz, 1H, H-2), 3.89 (dd, 3J3,2 = 3.5 Hz, 3J3,4 = 9.4 Hz, 1H, H-3), 3.78 (dd, 3J6,5 = 2.5 Hz, 2J6,6‘ = 11.9 Hz, 1H, H-6), 3.75–3.69 (m, 2H, Boc-NHCH2CH2), 3.72 (dd~t, 3J4,3 = 3J4,5 = 9.4 Hz, 1H, H-4), 3.71 (dd, 3J6‘,5 = 5.4 Hz, 2J6‘,6 = 11.9 Hz, 1H, H-6‘), 3.62 (ddd, 3J5,6 = 2.5 Hz, 3J5,6‘ = 5.4 Hz, 3J5,4 = 9.4 Hz, 1H, H-5), 3.29 (mc, 2H, Boc-NHCH2CH2), 1.40 (s, 9H, C(CH3)3) ppm; 13C NMR (126 MHz, MeOH-d4, 300 K) δ 185.0, 182.6 (2C, C=Osquaric acid), 170.7, 165.5 (2C, Csquaric acid), 154.7 (1C, Caryl-4), 134.6 (1C, Caryl-1), 121.7 (2C, CHaryl-2,6), 118.8 (2C, CHaryl-3,5), 100.6 (1C, C-1), 80.4 (1C, C(CH3)3), 75.4 (1C, C-5), 72.4 (1C, C-3), 72.0 (1C, C-2), 68.4 (1C, C-4), 62.7 (1C, C-6), 45.3 (1C, Boc-NHCH2CH2), 42.4 (1C, Boc-NHCH2CH2), 28.7 (3C, C(CH3)3) ppm; MALDI–TOF MS m/z: 532.16 [M + Na]+, 548.14 [M + K]+; ESIMS m/z: 532.3 [M + Na]+.

Supporting Information

Supporting Information File 1: NMR spectra of the synthetic compounds 3, 4, 7, and 11, docking results obtained with 3 and 4, and MS and MS/MS spectra of labeling experiments.
Format: PDF Size: 1.4 MB Download

Acknowledgements

Financial support by the DFG-Cluster of Excellence “Inflammation at Interfaces” and by the DFG Collaborative Network SFB 677 is gratefully acknowledged.

References

  1. Robinette, D.; Neamati, N.; Tomer, K. B.; Borchers, C. H. Expert Rev. Proteomics 2006, 3, 399–408. doi:10.1586/14789450.3.4.399
    Return to citation in text: [1]
  2. Sumranjit, J.; Chung, S. J. Molecules 2013, 18, 10425–10451. doi:10.3390/molecules180910425
    Return to citation in text: [1]
  3. Smith, E.; Collins, I. Future Med. Chem. 2015, 7, 159–183. doi:10.4155/fmc.14.152
    Return to citation in text: [1]
  4. Murale, D. P.; Hong, S. C.; Haque, M. M.; Lee, J.-S. Proteome Sci. 2017, 15, No. 14. doi:10.1186/s12953-017-0123-3
    Return to citation in text: [1]
  5. Dubinsky, L.; Krom, B. P.; Meijler, M. M. Bioorg. Med. Chem. 2012, 20, 554–570. doi:10.1016/j.bmc.2011.06.066
    Return to citation in text: [1]
  6. Hashimoto, M.; Hatanaka, Y. Eur. J. Org. Chem. 2008, 2513–2523. doi:10.1002/ejoc.200701069
    Return to citation in text: [1]
  7. Brunner, J.; Senn, H.; Richards, F. M. J. Biol. Chem. 1980, 255, 3313–3318.
    Return to citation in text: [1]
  8. Hatanaka, Y.; Hashimoto, M.; Kurihara, H.; Nakayama, H.; Kanaoka, Y. J. Org. Chem. 1994, 59, 383–387. doi:10.1021/jo00081a017
    Return to citation in text: [1]
  9. Walter, M.; Lindhorst, T. K. Synthesis 2006, 952–958. doi:10.1055/s-2006-926358
    Return to citation in text: [1]
  10. Walter, M.; Wiegand, M.; Lindhorst, T. K. Eur. J. Org. Chem. 2006, 719–728. doi:10.1002/ejoc.200500692
    Return to citation in text: [1]
  11. Wiegand, M.; Lindhorst, T. K. Eur. J. Org. Chem. 2006, 4841–4851. doi:10.1002/ejoc.200600449
    Return to citation in text: [1] [2] [3]
  12. Sakurai, K.; Yasui, T.; Mizuno, S. Asian J. Org. Chem. 2015, 4, 681–817. doi:10.1002/ajoc.201580801
    Return to citation in text: [1]
  13. Knight, S. D.; Bouckaert, J. Top. Curr. Chem. 2009, 288, 67–107. doi:10.1007/128_2008_13
    Return to citation in text: [1]
  14. Hartmann, M.; Lindhorst, T. K. Eur. J. Org. Chem. 2011, 3583–3609. doi:10.1002/ejoc.201100407
    Return to citation in text: [1]
  15. Lindhorst, T. K. In Synthesis and Biological Applications of Glycoconjugates; Renaudet, O.; Spinelli, N., Eds.; Bentham Science e-Books, 2011; pp 12–35.
    Return to citation in text: [1]
  16. Flores-Mireles, A. L.; Walker, J. N.; Caparon, M.; Hultgren, S. J. Nat. Rev. Microbiol. 2015, 13, 269–284. doi:10.1038/nrmicro3432
    Return to citation in text: [1]
  17. Kleeb, S.; Pang, L.; Mayer, K.; Eris, D.; Sigl, A.; Preston, R. C.; Zihlmann, P.; Sharpe, T.; Jakob, R. P.; Abgottspon, D.; Hutter, A. S.; Scharenberg, M.; Jiang, X.; Navarra, G.; Rabbani, S.; Smieško, M.; Lüdin, N.; Bezençon, J.; Schwardt, O.; Maier, T.; Ernst, B. J. Med. Chem. 2015, 58, 2221–2239. doi:10.1021/jm501524q
    Return to citation in text: [1]
  18. Wurpel, D. J.; Totsika, M.; Allsopp, L. P.; Webb, R. I.; Moriel, D. G.; Schembri, M. A. Proteomics 2016, 131, 177–189. doi:10.1016/j.jprot.2015.11.001
    Return to citation in text: [1]
  19. Sperling, O.; Fuchs, A.; Lindhorst, T. K. Org. Biomol. Chem. 2006, 4, 3913–3922. doi:10.1039/b610745a
    Return to citation in text: [1] [2] [3]
  20. Fiege, B.; Rabbani, S.; Preston, R. C.; Jakob, R. P.; Zihlmann, P.; Schwardt, O.; Jiang, X.; Maier, T.; Ernst, B. ChemBioChem 2015, 16, 1235–1246. doi:10.1002/cbic.201402714
    Return to citation in text: [1] [2]
  21. Kramer, B.; Metz, G.; Rarey, M.; Lengauer, T. Med. Chem. Res. 1999, 9, 463–478.
    Return to citation in text: [1]
  22. Rarey, M.; Kramer, B.; Lengauer, T.; Klebe, G. J. Mol. Biol. 1996, 261, 470–489. doi:10.1006/jmbi.1996.0477
    Return to citation in text: [1]
  23. Rarey, M.; Kramer, B.; Lengauer, T. J. Comput.-Aided Mol. Des. 1997, 11, 369–384. doi:10.1023/A:1007913026166
    Return to citation in text: [1]
  24. Tripos Inc. SYBYL, 6.9; Tripos Inc.: St. Louis, 2002.
    Return to citation in text: [1]
  25. Connolly, M. L. Science 1983, 221, 709–713. doi:10.1126/science.6879170
    Return to citation in text: [1]
  26. Chernyak, A. Y.; Sharma, G. V. M.; Kononov, L. O.; Krishna, P. R.; Levinsky, A. B.; Kochetkov, N. K.; Rao, A. V. R. Carbohydr. Res. 1992, 223, 303–309. doi:10.1016/0008-6215(92)80029-Z
    Return to citation in text: [1] [2] [3]
  27. Šardzík, R.; Noble, G. T.; Weissenborn, M. J.; Martin, A.; Webb, S. J.; Flitsch, S. L. Beilstein J. Org. Chem. 2010, 6, 699–703. doi:10.3762/bjoc.6.81
    Return to citation in text: [1] [2] [3]
  28. Nassal, M. Liebigs Ann. Chem. 1983, 1510–1523. doi:10.1002/jlac.198319830907
    Return to citation in text: [1] [2] [3]
  29. Kumar, A. B.; Tipton, J. D.; Manetsch, R. Chem. Commun. 2016, 52, 2729–2732. doi:10.1039/C5CC09518B
    Return to citation in text: [1] [2]
  30. Gee, C. T.; Arntson, K. E.; Urick, A. K.; Mishra, N. K.; Hawk, L. M. L.; Wisniewski, A. J.; Pomerantz, W. C. K. Nat. Protoc. 2016, 11, 1414–1427. doi:10.1038/nprot.2016.079
    Return to citation in text: [1]
  31. Bouckaert, J.; Berglund, J.; Schembri, M.; De Genst, E.; Cools, L.; Wuhrer, M.; Hung, C.-S.; Pinkner, J.; Slättegård, R.; Zavialov, A.; Choudhury, D.; Langermann, S.; Hultgren, S. J.; Wyns, L.; Klemm, P.; Oscarson, S.; Knight, S. D.; De Greve, H. Mol. Microbiol. 2005, 55, 441–455. doi:10.1111/j.1365-2958.2004.04415.x
    Return to citation in text: [1]

Interesting articles

Thisbe K. Lindhorst , Michaela Märten , Andreas Fuchs and Stefan D. Knight

Tobias-Elias Gloe , Insa Stamer , Cornelia Hojnik , Tanja M. Wrodnigg and Thisbe K. Lindhorst

Vladimir N. Zhabinskii , Darya A. Osiyuk , Yuri V. Ermolovich , Natalia M. Chaschina , Tatsiana S. Dalidovich , Miroslav Strnad and Vladimir A. Khripach

© 2018 Beiroth et al.; licensee Beilstein-Institut.
This is an Open Access article under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0). Please note that the reuse, redistribution and reproduction in particular requires that the authors and source are credited.
The license is subject to the Beilstein Journal of Organic Chemistry terms and conditions: (https://www.beilstein-journals.org/bjoc)

 
Back to Article List